LRRC51 Antibody - N-terminal region : Biotin

LRRC51 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55466_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of LRRC51 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC51

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 51

Protein Size: 192

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55466_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55466_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 220074
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×