LRRFIP2 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of LRRFIP2 remains unknown.

Molecular Weight: 82kDa

Peptide Sequence: Synthetic peptide located within the following region: RKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQISEYK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leucine-rich repeat flightless-interacting protein 2

Protein Size: 721

Purification: Affinity Purified

• Artikelnummer: AVIARP59018_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59018_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 9209
• Wirt: Rabbit
• Konjugat: Conjugated, HRP