LUC7L Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LUC7L

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative RNA-binding protein Luc7-like 1

Protein Size: 371

Purification: Affinity Purified

• Artikelnummer: AVIARP57815_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57815_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55692
• Wirt: Rabbit