LYPD4 Antibody - N-terminal region : FITC

LYPD4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58637_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of LYPD4 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYPD4

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ly6/PLAUR domain-containing protein 4

Protein Size: 246

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58637_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58637_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 147719
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×