LYPD4 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of LYPD4 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYPD4

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ly6/PLAUR domain-containing protein 4

Protein Size: 246

Purification: Affinity Purified

• Artikelnummer: AVIARP58637_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58637_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 147719
• Wirt: Rabbit
• Konjugat: Conjugated, HRP