English
LYPLA2 Antibody - N-terminal region : Biotin
LYPLA2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58638_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYPLA2
Key Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72
Molecular Weight: 25kDa
Peptide Sequence: Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Acyl-protein thioesterase 2
Protein Size: 231
Purification: Affinity Purified
Description of Target: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYPLA2
Key Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72
Molecular Weight: 25kDa
Peptide Sequence: Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Acyl-protein thioesterase 2
Protein Size: 231
Purification: Affinity Purified
| Artikelnummer | AVIARP58638_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58638_P050-Biotin |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Immunohistochemistry |
| Human Gene ID | 11313 |
| Wirt | Rabbit |
| Konjugat | Conjugated, Biotin |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
