LYRM1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: LYRM1 may promote cell proliferation and inhibition of apoptosis of preadipocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYRM1

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LYR motif-containing protein 1

Protein Size: 122

Purification: Affinity Purified

• Artikelnummer: AVIARP57413_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57413_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57149
• Wirt: Rabbit