LZTS2 Antibody - N-terminal region : Biotin

LZTS2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58817_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis. LZTS2 may negatively regulate axonal outgrowth by preventing the for

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LZTS2

Key Reference: Hyun (2008) Biochim. Biophys. Acta 1783 (3), 419-428

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine zipper putative tumor suppressor 2

Protein Size: 669

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58817_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58817_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 84445
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×