LZTS2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis. LZTS2 may negatively regulate axonal outgrowth by preventing the for

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LZTS2

Key Reference: Hyun (2008) Biochim. Biophys. Acta 1783 (3), 419-428

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leucine zipper putative tumor suppressor 2

Protein Size: 669

Purification: Affinity Purified

• Artikelnummer: AVIARP58817_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58817_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 84445
• Wirt: Rabbit
• Konjugat: Conjugated, HRP