MAB21L1 Antibody - N-terminal region : Biotin

MAB21L1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54782_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders. There is evidence that this gene has 2 transcripts with alternate polyA sites, but the full length nature of the longer transcript has not been defined. Sequence Note: The sequence U38810.1 is a chimeric mRNA clone. Only the mab-21-like protein 1 region was propagated into this RefSeq record.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAB21L1

Key Reference: Smith,M., (2002) Cytogenet. Genome Res. 98 (4), 233-239

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein mab-21-like 1

Protein Size: 359

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54782_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54782_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4081
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×