MAGEB1 Antibody - middle region : Biotin

MAGEB1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57757_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAGEB1

Key Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen B1

Protein Size: 347

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57757_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57757_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4112
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×