MAGEB1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAGEB1

Key Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: QEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen B1

Protein Size: 347

Purification: Affinity Purified

• Artikelnummer: AVIARP57756_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57756_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4112
• Wirt: Rabbit