MAGEB2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB2

Key Reference: Milutinovic,S., (2007) Carcinogenesis 28 (3), 560-571

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen B2

Protein Size: 319

Purification: Affinity Purified

• Artikelnummer: AVIARP56336_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56336_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4113
• Wirt: Rabbit