MAPK1 Antibody - middle region : Biotin

MAPK1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58900_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK1

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: RDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 1

Protein Size: 360

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58900_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58900_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5594
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×