Mapk11 Antibody - N-terminal region : Biotin

Mapk11 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56438_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Mapk11

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: VPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Mapk11 Ensembl ENSRNOP00000009325

Protein Size: 364

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56438_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56438_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 689314
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×