English
MAPK7 Antibody - middle region : FITC
MAPK7 Antibody - middle region : FITC
Artikelnummer
AVIARP57731_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK7
Molecular Weight: 88kDa
Peptide Sequence: Synthetic peptide located within the following region: FDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSP
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Mitogen-activated protein kinase 7
Protein Size: 816
Purification: Affinity Purified
Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK7
Molecular Weight: 88kDa
Peptide Sequence: Synthetic peptide located within the following region: FDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSP
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Mitogen-activated protein kinase 7
Protein Size: 816
Purification: Affinity Purified
| Artikelnummer | AVIARP57731_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57731_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Immunohistochemistry |
| Human Gene ID | 5598 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
