Mapk8ip2 Antibody - middle region : Biotin

Mapk8ip2 Antibody - middle region : Biotin
Artikelnummer
AVIARP55343_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Mapk8ip2

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: SEPEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 8 interacting protein 2 EMBL EDL76573.1

Protein Size: 835

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55343_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55343_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 315220
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×