MEAK7 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1609

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: LSAQENFQFDKMEVWAVGDPSEEQLAKGNKSILDADPEAQALLEISGHSR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TLD domain-containing protein 1

Protein Size: 456

Purification: Affinity Purified

• Artikelnummer: AVIARP57504_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57504_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57707
• Wirt: Rabbit