MED16 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MED16 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. It mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MED16

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: IVALSWLHNGVKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 16

Protein Size: 663

Purification: Affinity Purified

• Artikelnummer: AVIARP57928_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57928_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10025
• Wirt: Rabbit