MED19 Antibody - middle region : Biotin

MED19 Antibody - middle region : Biotin
Artikelnummer
AVIARP55596_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MED19

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 19

Protein Size: 244

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55596_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55596_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 219541
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×