MED19 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MED19

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mediator of RNA polymerase II transcription subunit 19

Protein Size: 244

Purification: Affinity Purified

• Artikelnummer: AVIARP55596_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55596_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Chromatin Immunoprecipitation (ChIP)
• Human Gene ID: 219541
• Wirt: Rabbit