MED31 Antibody - N-terminal region : HRP

MED31 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56820_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MED31

Key Reference: Cavdar (er) World J Surg (2008) In press

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mediator of RNA polymerase II transcription subunit 31

Protein Size: 131

Purification: Affinity Purified

Subunit: 31
Mehr Informationen
Artikelnummer AVIARP56820_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56820_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 51003
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×