MEFV antibody

Application Note: WB: 0.1-0.5μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 86

Form: Liquid

Buffer (with preservative): 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome. [provided by RefSeq, Jul 2008]

Uniprot ID: O15553

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR).

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: MEFV innate immuity regulator, pyrin

• Artikelnummer: GTX01088-100
• Hersteller: GeneTex
• Hersteller Artikelnummer: GTX01088-100
• Green Labware: Nein
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 4210
• Wirt: Rabbit