MEIOB Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MEIOB

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: ANILLNFIRENKETNVLDDEIDSYFKESINLSTIVDVYTVEQLKGKALKN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Meiosis-specific with OB domain-containing protein Ensembl ENSP00000390778 Ensembl ENSP00000314484

Protein Size: 471

Purification: Affinity Purified

• Artikelnummer: AVIARP55533_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55533_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 254528
• Wirt: Rabbit