MFAP2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MFAP2

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Microfibrillar-associated protein 2

Protein Size: 183

Purification: Affinity Purified

• Artikelnummer: AVIARP56961_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56961_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4237
• Wirt: Rabbit