MFN1 Antibody - N-terminal region : FITC

MFN1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57701_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MFN1

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: SVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitofusin-1

Protein Size: 370

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57701_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57701_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55669
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×