MFSD3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MFSD3

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LKLAWAPLVDAQGSARAWVTRSTAGLGLVCGLLAGLPPPGAGQAGLPAAV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Major facilitator superfamily domain-containing protein 3

Protein Size: 412

Purification: Affinity purified

• Artikelnummer: AVIARP58372_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58372_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 113655
• Wirt: Rabbit
• Konjugat: Conjugated, FITC