MFSD8 Antibody - middle region : FITC

MFSD8 Antibody - middle region : FITC
Artikelnummer
AVIARP55547_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The protein likely localizes to lysosomal membranes. Mutations in this gene are correlated with a variant form of late infantile-onset neuronal ceroid lipofuscinoses (vLINCL).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MFSD8

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Major facilitator superfamily domain-containing protein 8

Protein Size: 518

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55547_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55547_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 256471
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×