MGAT4D Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC152586

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: KPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGIHSSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D

Protein Size: 166

Purification: Affinity Purified

• Artikelnummer: AVIARP56050_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56050_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Dog (Canine), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 152586
• Wirt: Rabbit