MGAT4D Antibody - middle region : HRP

MGAT4D Antibody - middle region : HRP
Artikelnummer
AVIARP56050_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC152586

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: KPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGIHSSF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D

Protein Size: 166

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56050_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56050_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 152586
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×