MGC48628 Antibody - N-terminal region : FITC

MGC48628 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56006_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC48628

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM190A

Protein Size: 677

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56006_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56006_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 401145
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×