MINDY4B Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC646951

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: inactive ubiquitin carboxyl-terminal hydrolase MINDY-4B

Protein Size: 460

Purification: Affinity Purified

• Artikelnummer: AVIARP58494_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58494_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 646951
• Wirt: Rabbit
• Konjugat: Conjugated, FITC