MKNK2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MKNK2

Key Reference: Wang,P., (2006) Sci. China, C, Life Sci. 49 (3), 265-273

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAP kinase-interacting serine/threonine-protein kinase 2

Protein Size: 465

Purification: Affinity Purified

• Artikelnummer: AVIARP55352_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55352_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 2872
• Wirt: Rabbit