MLX Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MLX belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. MLX may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MLX

Key Reference: Stoltzman,C.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (19), 6912-6917

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: GSCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Max-like protein X

Protein Size: 244

Purification: Affinity Purified

• Artikelnummer: AVIARP58362_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58362_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6945
• Wirt: Rabbit
• Konjugat: Conjugated, FITC