MMP13 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MMP13

Key Reference: Borghese,B., (2008) Hum. Reprod. 23 (5), 1207-1213

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Collagenase 3

Protein Size: 471

Purification: Affinity Purified

• Artikelnummer: AVIARP56350_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56350_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4322
• Wirt: Rabbit