MOS Antibody - middle region : Biotin

MOS Antibody - middle region : Biotin
Artikelnummer
AVIARP56631_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MOS

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proto-oncogene serine/threonine-protein kinase mos

Protein Size: 346

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56631_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56631_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4342
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×