Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 24-203
Amino Acid Sequence: SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Background: LIF, a multifunctional, secreted glycoprotein that exists in both soluble and matrix-bound forms, displays biologic activities ranging from the differentiation of myeloid leukemic cells into macrophage lineage to effects on bone metabolism, inflammation, neural development, embryogenesis, and the maintenance of implantation. It is clear that LIF is related in both structure and mechanism of action to the interleukin (IL)-6 family of cytokines, which also includes IL-11, ciliary neurotrophic factor, oncostatin M, and cardiotrophin 1. The actions of these cytokines are mediated through specific cell-surface receptors that consist of a unique chain and the shared signal transducing subunit gp130.
Biological Activity: The ED50 was determined by the dose-dependent differentiation of M1 myeloid leukemic cells to be in the range of 0.01 ng/ml.
Description: LIF is a disulfide-linked monomer protein consisting of 181 amino acid residues, and migrates as an approximately 20 kDa protein under non-reducingand reducing conditions in SDS-PAGE. Optimized DNA sequence encoding murine LIF mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 7.5.
Genbank: P09056
Purity: ≥98% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P09056
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Endocrinology, Jun 2009, 150: 2915 - 2923.
2. Invest. Ophthalmol. Vis. Sci., Apr 2009, 50: 3880.
3. Invest. Ophthalmol. Vis. Sci., Apr 2009, 50: 682.