Mouse Stem Cell Factor Recombinant

Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 26-189

Amino Acid Sequence: KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Background: SCF is a stromal cell-derived cytokine synthesized by fibroblasts and other cell types. SCF promotes proliferation and early differentiation of cells at the level of multipotential stem cells. It has been suggested that SCF is essential for optimal production of various hematopoietic lineages, mainly because of its ability to prevent apoptosis when it co-stimulates with other cytokines. The receptor for SCF, designated SCFR(CD117), is the oncogene designated as KIT. The biological activities of SCF are synergised considerably by colony stimulating factors GM-CSF and G-CSF, and also by IL-7, Epo and some other growth and differentiation factors. In combination with IL-7, SCF stimulates the proliferation of pre-B-cells. SCF is also a potent chemoattractant for cells, for example, mast cells, expressing the kit receptor. One response to SCF in these cells is a characteristic rearrangement of the actin filaments of the cytoskeleton.

Biological Activity: The ED₅₀ was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is <2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg.

Description: Recombinant SCF (Kit Ligand) is a disulfide-linked monomer protein consisting of 165 amino acid residues, and due to glycosylation migrates as an approximately 23 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding murine SCF mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered solution in 20 mM Tris, 5% trehalose, pH 7.5.

Genbank: P20826

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P20826

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Bedell MA, et al. J Androl. 2004 Mar-Apr,25(2):188-99.
2. Heissig B, et al. Thromb Haemost. 2003 Oct,90(4):570-6.
3. Wehrle-Haller B. Pigment Cell Res. 2003 Jun,16(3):287-96.

• Artikelnummer: BPS90236-B
• Hersteller: BPS Bioscience
• Hersteller Artikelnummer: 90236-B
• Verpackungseinheit: 10 µg
• Mengeneinheit: STK