Mpc1 Antibody - N-terminal region : FITC

Mpc1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56834_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mpc1 may be involved in apoptosis of neuronal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Mpc1

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: GALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial pyruvate carrier 1

Protein Size: 109

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56834_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56834_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Cow (Bovine), Yeast
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 171087
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×