Mpp2 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mpp2 is a protein related to CASK that may play a role in synaptic vesicle exocytosis and synaptic junctions.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Mpp2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: ADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2), isoform CRA_a EMBL EDM06167.1

Protein Size: 552

Purification: Affinity Purified

• Artikelnummer: AVIARP56633_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56633_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 85275
• Wirt: Rabbit