MPP3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MPP3

Key Reference: Kantardzhieva,A., (2006) FEBS J. 273 (6), 1152-1165

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: GVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MAGUK p55 subfamily member 3

Protein Size: 585

Purification: Affinity Purified

• Artikelnummer: AVIARP56335_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56335_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4356
• Wirt: Rabbit