MPV17L Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MPV17L

Key Reference: Iida,R., (2006) Biochem. Biophys. Res. Commun. 344 (3), 948-954

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mpv17-like protein

Protein Size: 196

Purification: Affinity Purified

• Artikelnummer: AVIARP55695_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55695_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 255027
• Wirt: Rabbit