MRPL37 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL37

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 39S ribosomal protein L37, mitochondrial

Protein Size: 423

Purification: Affinity Purified

• Artikelnummer: AVIARP56924_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56924_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51253
• Wirt: Rabbit