English
MS4A4A Antibody - N-terminal region : FITC
MS4A4A Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58497_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: MS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MS4A4A
Key Reference: Liang,Y., (2001) Immunogenetics 53 (5), 357-368
Molecular Weight: 26kDa
Peptide Sequence: Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Membrane-spanning 4-domains subfamily A member 4A
Protein Size: 239
Purification: Affinity Purified
Description of Target: MS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MS4A4A
Key Reference: Liang,Y., (2001) Immunogenetics 53 (5), 357-368
Molecular Weight: 26kDa
Peptide Sequence: Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Membrane-spanning 4-domains subfamily A member 4A
Protein Size: 239
Purification: Affinity Purified
| Artikelnummer | AVIARP58497_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58497_P050-FITC |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 51338 |
| Wirt | Rabbit |
| Konjugat | Conjugated, FITC |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
