MS4A4A Antibody - N-terminal region : HRP

MS4A4A Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58497_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MS4A4A

Key Reference: Liang,Y., (2001) Immunogenetics 53 (5), 357-368

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Membrane-spanning 4-domains subfamily A member 4A

Protein Size: 239

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58497_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58497_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51338
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×