MTBP Antibody - middle region : Biotin

MTBP Antibody - middle region : Biotin
Artikelnummer
AVIARP55384_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein that interacts with the oncoprotein mouse double minute 2. The encoded protein regulates progression through the cell cycle and may be involved in tumor formation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTBP

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: mdm2-binding protein

Protein Size: 329

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55384_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55384_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27085
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×