MTIF3 Antibody - middle region : HRP

MTIF3 Antibody - middle region : HRP
Artikelnummer
AVIARP55563_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTIF3

Key Reference: Abahuni,N., (2007) Neurosci. Lett. 414 (2), 126-129

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Translation initiation factor IF-3, mitochondrial

Protein Size: 278

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55563_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55563_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 219402
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×