MUC3B Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MUC3B

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 1009

Purification: Affinity Purified

• Artikelnummer: AVIARP58396_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58396_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57876
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin