MVP Antibody - N-terminal region : Biotin

MVP Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58642_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.This gene encodes the major vault protein which is a lung resistance-related protein. Vaults are multi-subunit structures that may be involved in nucleo-cytoplasmic transport. This protein mediates drug resistance, perhaps via a transport process. It is widely distributed in normal tissues, and overexpressed in multidrug-resistant cancer cells. The protein overexpression is a potentially useful marker of clinical drug resistance. This gene produces two transcripts by using two alternative exon 2 sequences; however, the open reading frames are the same in both transcripts.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MVP

Key Reference: de (2008) Cytometry B Clin Cytom 74 (3), 163-168

Molecular Weight: 98kDa

Peptide Sequence: Synthetic peptide located within the following region: MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Major vault protein

Protein Size: 893

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58642_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58642_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9961
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×