MYD88 Antibody - middle region : FITC

MYD88 Antibody - middle region : FITC
Artikelnummer
AVIARP58919_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYD88

Molecular Weight: 32 kDa

Peptide Sequence: Synthetic peptide located within the following region: NVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: myeloid differentiation primary response protein MyD88

Protein Size: 296

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP58919_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58919_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4615
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×